SIRT1 monoclonal antibody (M01), clone 7B7
  • SIRT1 monoclonal antibody (M01), clone 7B7

SIRT1 monoclonal antibody (M01), clone 7B7

Ref: AB-H00023411-M01
SIRT1 monoclonal antibody (M01), clone 7B7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SIRT1.
Información adicional
Size 100 ug
Gene Name SIRT1
Gene Alias SIR2L1
Gene Description sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq NRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SIRT1 (AAH12499, 456 a.a. ~ 555 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23411
Clone Number 7B7
Iso type IgG1 Kappa

Enviar un mensaje


SIRT1 monoclonal antibody (M01), clone 7B7

SIRT1 monoclonal antibody (M01), clone 7B7