SIRT4 monoclonal antibody (M03), clone 1C8
  • SIRT4 monoclonal antibody (M03), clone 1C8

SIRT4 monoclonal antibody (M03), clone 1C8

Ref: AB-H00023409-M03
SIRT4 monoclonal antibody (M03), clone 1C8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SIRT4.
Información adicional
Size 100 ug
Gene Name SIRT4
Gene Alias MGC130046|MGC130047|MGC57437|SIR2L4
Gene Description sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQVYSGYRFILTAWEKKLPIAILNIGPTRSDDLACLKLNSRCGELLPLIDPC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SIRT4 (NP_036372.1, 215 a.a. ~ 314 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23409
Clone Number 1C8
Iso type IgG2a Kappa

Enviar un mensaje


SIRT4 monoclonal antibody (M03), clone 1C8

SIRT4 monoclonal antibody (M03), clone 1C8