SIRT5 purified MaxPab rabbit polyclonal antibody (D01P)
  • SIRT5 purified MaxPab rabbit polyclonal antibody (D01P)

SIRT5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023408-D01P
SIRT5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SIRT5 protein.
Información adicional
Size 100 ug
Gene Name SIRT5
Gene Alias FLJ36950|SIR2L5
Gene Description sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SIRT5 (NP_036373.1, 1 a.a. ~ 310 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23408

Enviar un mensaje


SIRT5 purified MaxPab rabbit polyclonal antibody (D01P)

SIRT5 purified MaxPab rabbit polyclonal antibody (D01P)