COTL1 monoclonal antibody (M01), clone 1A2
  • COTL1 monoclonal antibody (M01), clone 1A2

COTL1 monoclonal antibody (M01), clone 1A2

Ref: AB-H00023406-M01
COTL1 monoclonal antibody (M01), clone 1A2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant COTL1.
Información adicional
Size 100 ug
Gene Name COTL1
Gene Alias CLP|FLJ43657|MGC19733
Gene Description coactosin-like 1 (Dictyostelium)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COTL1 (AAH10884.1, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23406
Clone Number 1A2
Iso type IgG2b Kappa

Enviar un mensaje


COTL1 monoclonal antibody (M01), clone 1A2

COTL1 monoclonal antibody (M01), clone 1A2