PIP5K1C monoclonal antibody (M02), clone 2E9
  • PIP5K1C monoclonal antibody (M02), clone 2E9

PIP5K1C monoclonal antibody (M02), clone 2E9

Ref: AB-H00023396-M02
PIP5K1C monoclonal antibody (M02), clone 2E9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PIP5K1C.
Información adicional
Size 100 ug
Gene Name PIP5K1C
Gene Alias KIAA0589|LCCS3|PIP5K-GAMMA|PIP5Kgamma
Gene Description phosphatidylinositol-4-phosphate 5-kinase, type I, gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IP,ELISA
Immunogen Prot. Seq RPQEEPPAEEDLQQITVQVEPACSVEIVVPKEEDAGVEASPAGASAAVEVETASQASDEEGAPASQASDEEDAPATDIYFPTDERSWVYSPLHYSAQAPPASDGESD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIP5K1C (NP_036530, 561 a.a. ~ 667 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23396
Clone Number 2E9
Iso type IgG2a Kappa

Enviar un mensaje


PIP5K1C monoclonal antibody (M02), clone 2E9

PIP5K1C monoclonal antibody (M02), clone 2E9