LARS2 polyclonal antibody (A01)
  • LARS2 polyclonal antibody (A01)

LARS2 polyclonal antibody (A01)

Ref: AB-H00023395-A01
LARS2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LARS2.
Información adicional
Size 50 uL
Gene Name LARS2
Gene Alias KIAA0028|LEURS|MGC26121
Gene Description leucyl-tRNA synthetase 2, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VPRKLCAHYTWDASVLLQAWPAVDPEFLQQPEVVQMAVLINNKACGKIPVPQQVARDQDKVHEFVLQSELGVRLLQGRSIKKSFLSPRTALINFLVQD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LARS2 (NP_056155, 806 a.a. ~ 903 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23395

Enviar un mensaje


LARS2 polyclonal antibody (A01)

LARS2 polyclonal antibody (A01)