CRTC1 monoclonal antibody (M01), clone 8F9
  • CRTC1 monoclonal antibody (M01), clone 8F9

CRTC1 monoclonal antibody (M01), clone 8F9

Ref: AB-H00023373-M01
CRTC1 monoclonal antibody (M01), clone 8F9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CRTC1.
Información adicional
Size 100 ug
Gene Name CRTC1
Gene Alias FLJ14027|KIAA0616|MECT1|TORC1|WAMTP1
Gene Description CREB regulated transcription coactivator 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq ASHSGIPNIILTVTGESPPSLSKELTSSLAGVGDVSFDSDSQFPLDELKIDPLTLDGLHMLNDPDMVLADPATEDTFRMDRL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRTC1 (NP_056136.1, 553 a.a. ~ 634 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23373
Clone Number 8F9
Iso type IgG2a Kappa

Enviar un mensaje


CRTC1 monoclonal antibody (M01), clone 8F9

CRTC1 monoclonal antibody (M01), clone 8F9