PUM2 polyclonal antibody (A01)
  • PUM2 polyclonal antibody (A01)

PUM2 polyclonal antibody (A01)

Ref: AB-H00023369-A01
PUM2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PUM2.
Información adicional
Size 50 uL
Gene Name PUM2
Gene Alias FLJ36528|KIAA0235|MGC138251|MGC138253|PUMH2|PUML2
Gene Description pumilio homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DIMPSGRSRLLEDFRNNRFPNLQLRDLIGHIVEFSQDQHGSRFIQQKLERATPAERQMVFNEILQAAYQLMTDVFGNYVIQKFFEFGSLDQKLALATR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PUM2 (NP_056132, 701 a.a. ~ 798 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23369

Enviar un mensaje


PUM2 polyclonal antibody (A01)

PUM2 polyclonal antibody (A01)