PPP1R13B monoclonal antibody (M04), clone 6H1
  • PPP1R13B monoclonal antibody (M04), clone 6H1

PPP1R13B monoclonal antibody (M04), clone 6H1

Ref: AB-H00023368-M04
PPP1R13B monoclonal antibody (M04), clone 6H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPP1R13B.
Información adicional
Size 100 ug
Gene Name PPP1R13B
Gene Alias ASPP1|KIAA0771|p53BP2-like|p85
Gene Description protein phosphatase 1, regulatory (inhibitor) subunit 13B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MMPMILTVFLSNNEQILTEVPITPETTCRDVVEFCKEPGEGSCHLAEVWRGNERPIPFDHMMYEHLQKWGPRREEVKFFLRHEDSPTENS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPP1R13B (NP_056131.2, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23368
Clone Number 6H1
Iso type IgG2a Kappa

Enviar un mensaje


PPP1R13B monoclonal antibody (M04), clone 6H1

PPP1R13B monoclonal antibody (M04), clone 6H1