ARHGEF12 polyclonal antibody (A01)
  • ARHGEF12 polyclonal antibody (A01)

ARHGEF12 polyclonal antibody (A01)

Ref: AB-H00023365-A01
ARHGEF12 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ARHGEF12.
Información adicional
Size 50 uL
Gene Name ARHGEF12
Gene Alias DKFZp686O2372|KIAA0382|LARG|PRO2792
Gene Description Rho guanine nucleotide exchange factor (GEF) 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VSREGILSPSELRKIFSNLEDILQLHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARHGEF12 (NP_056128, 817 a.a. ~ 916 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23365

Enviar un mensaje


ARHGEF12 polyclonal antibody (A01)

ARHGEF12 polyclonal antibody (A01)