RBAF600 polyclonal antibody (A01)
  • RBAF600 polyclonal antibody (A01)

RBAF600 polyclonal antibody (A01)

Ref: AB-H00023352-A01
RBAF600 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RBAF600.
Información adicional
Size 50 uL
Gene Name UBR4
Gene Alias FLJ41863|KIAA0462|KIAA1307|RBAF600|ZUBR1|p600
Gene Description ubiquitin protein ligase E3 component n-recognin 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RNQLQSVAAACKVLIEFSLLRLENPDEACAVSQKHLILLIKGLCTGCSRLDRTEIITFTAMMKSAKLPQTVKTLSDVEDQKELASPVSPELRQKEVQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RBAF600 (NP_065816, 94 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23352

Enviar un mensaje


RBAF600 polyclonal antibody (A01)

RBAF600 polyclonal antibody (A01)