FAM62A purified MaxPab mouse polyclonal antibody (B01P)
  • FAM62A purified MaxPab mouse polyclonal antibody (B01P)

FAM62A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023344-B01P
FAM62A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FAM62A protein.
Información adicional
Size 50 ug
Gene Name FAM62A
Gene Alias KIAA0747|MBC2
Gene Description family with sequence similarity 62 (C2 domain containing), member A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MERSPGEGPSPSPMDQPSAPSDPTDQPPAAHAKPDPGSGGQPAGPGAAGEALAVLTSFGRRLLVLIPVYLAGAVGLSVGFVLFGLALYLGWRRVRDEKERSLRAARQLLDDEEQLTAKTLYMSHRELPAWVSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGSNPHLQTFTFTRVELGEKPLRIIGVKVHPGQRKEQILLDLNISYVGDVQIDVEVKKYFCKAGVKGMQLHGVLRVILEPLIGDLP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FAM62A (NP_056107.1, 1 a.a. ~ 1104 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23344

Enviar un mensaje


FAM62A purified MaxPab mouse polyclonal antibody (B01P)

FAM62A purified MaxPab mouse polyclonal antibody (B01P)