CLASP1 polyclonal antibody (A01)
  • CLASP1 polyclonal antibody (A01)

CLASP1 polyclonal antibody (A01)

Ref: AB-H00023332-A01
CLASP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CLASP1.
Información adicional
Size 50 uL
Gene Name CLASP1
Gene Alias DKFZp686D1968|DKFZp686H2039|FLJ33821|FLJ41222|KIAA0622|MAST1|MGC131895
Gene Description cytoplasmic linker associated protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDTENLNSEEIYSSLRGVTEAIEKFSFRSQEDLNEPIKRDGKKECDIVSRDGGAASPAT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLASP1 (NP_056097, 1133 a.a. ~ 1226 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23332

Enviar un mensaje


CLASP1 polyclonal antibody (A01)

CLASP1 polyclonal antibody (A01)