NEDD4L monoclonal antibody (M04), clone 1D2
  • NEDD4L monoclonal antibody (M04), clone 1D2

NEDD4L monoclonal antibody (M04), clone 1D2

Ref: AB-H00023327-M04
NEDD4L monoclonal antibody (M04), clone 1D2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NEDD4L.
Información adicional
Size 100 ug
Gene Name NEDD4L
Gene Alias FLJ33870|KIAA0439|NEDD4-2|RSP5|hNedd4-2
Gene Description neural precursor cell expressed, developmentally down-regulated 4-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NEDD4L (AAH32597, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23327
Clone Number 1D2
Iso type IgG2a Kappa

Enviar un mensaje


NEDD4L monoclonal antibody (M04), clone 1D2

NEDD4L monoclonal antibody (M04), clone 1D2