NEDD4L polyclonal antibody (A01)
  • NEDD4L polyclonal antibody (A01)

NEDD4L polyclonal antibody (A01)

Ref: AB-H00023327-A01
NEDD4L polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NEDD4L.
Información adicional
Size 50 uL
Gene Name NEDD4L
Gene Alias FLJ33870|KIAA0439|NEDD4-2|RSP5|hNedd4-2
Gene Description neural precursor cell expressed, developmentally down-regulated 4-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NEDD4L (AAH32597, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23327

Enviar un mensaje


NEDD4L polyclonal antibody (A01)

NEDD4L polyclonal antibody (A01)