MAN2B2 purified MaxPab mouse polyclonal antibody (B01P)
  • MAN2B2 purified MaxPab mouse polyclonal antibody (B01P)

MAN2B2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023324-B01P
MAN2B2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MAN2B2 protein.
Información adicional
Size 50 ug
Gene Name MAN2B2
Gene Alias KIAA0935
Gene Description mannosidase, alpha, class 2B, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGQLCWLPLLAPLLLLRPPGVQSAGPIRAFVVPHSHMDVGWVYTVQESMRAYAANVYTSVVEELARGQQRRFIAVEQEFFRLWWDGVASDQQKYQVRQLLEEGRLEFVIGGQVMHDEAVTHLDDQILQLTEGHGFLYETFGIRPQFSWHVDPFGASATTPTLFALAGFNAHLGSRIDYDLKAAMQEARGLQFVWRGSPSLSERQEIFTHIMDQYSYCTPSHIPFSNRSGFYWNGVAVFPKPPPDGVYPNMSEPVT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MAN2B2 (AAH94773.1, 1 a.a. ~ 1009 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23324

Enviar un mensaje


MAN2B2 purified MaxPab mouse polyclonal antibody (B01P)

MAN2B2 purified MaxPab mouse polyclonal antibody (B01P)