ZCCHC11 purified MaxPab rabbit polyclonal antibody (D01P)
  • ZCCHC11 purified MaxPab rabbit polyclonal antibody (D01P)

ZCCHC11 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023318-D01P
ZCCHC11 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ZCCHC11 protein.
Información adicional
Size 100 ug
Gene Name ZCCHC11
Gene Alias PAPD3
Gene Description zinc finger, CCHC domain containing 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEESKTLKSENHEPKKNVICEESKAVQVIGNQTLKARNDKSVKEIENSSPNRNSSKKNKQNDICIEKTEVKSCKVNAANLPGPKDLGLVLRDQSHCKAKKFPNSPVKAEKATISQAKSEKATSLQAIAEKSPKSPNSVKAEKASSYQMKSEKVPSSPAEAEKGPSLLLKDMRQKTELQQIGKKIPSSFTSVDKVNIEAVGGEKCALQNSPRSQKQQTCTDNTGDSDDSASGIEDVSDDLSKMKNDESNKENSSEM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZCCHC11 (AAH48301.1, 1 a.a. ~ 309 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23318

Enviar un mensaje


ZCCHC11 purified MaxPab rabbit polyclonal antibody (D01P)

ZCCHC11 purified MaxPab rabbit polyclonal antibody (D01P)