SIN3B monoclonal antibody (M02), clone 2C11
  • SIN3B monoclonal antibody (M02), clone 2C11

SIN3B monoclonal antibody (M02), clone 2C11

Ref: AB-H00023309-M02
SIN3B monoclonal antibody (M02), clone 2C11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SIN3B.
Información adicional
Size 100 ug
Gene Name SIN3B
Gene Alias KIAA0700
Gene Description SIN3 homolog B, transcription regulator (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq HKMVFIVNSEDYMYRRGTLCRAKQVQPLVLLRHHQHFEEWHSRWLEDNVTVEAASLVQDWLMGEEDEDMVPCKTLCETVHVHGLPVTRYRVQYSRRPA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SIN3B (NP_056075.1, 1063 a.a. ~ 1160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23309
Clone Number 2C11
Iso type IgG2a Kappa

Enviar un mensaje


SIN3B monoclonal antibody (M02), clone 2C11

SIN3B monoclonal antibody (M02), clone 2C11