ICOSLG monoclonal antibody (M09), clone 4A11
  • ICOSLG monoclonal antibody (M09), clone 4A11

ICOSLG monoclonal antibody (M09), clone 4A11

Ref: AB-H00023308-M09
ICOSLG monoclonal antibody (M09), clone 4A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ICOSLG.
Información adicional
Size 100 ug
Gene Name ICOSLG
Gene Alias B7-H2|B7H2|B7RP-1|B7RP1|CD275|GL50|ICOS-L|ICOSL|KIAA0653|LICOS
Gene Description inducible T-cell co-stimulator ligand
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ICOSLG (AAH64637.1, 18 a.a. ~ 135 a.a) partial recombinant protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23308
Clone Number 4A11
Iso type IgG1 Kappa

Enviar un mensaje


ICOSLG monoclonal antibody (M09), clone 4A11

ICOSLG monoclonal antibody (M09), clone 4A11