UBR2 monoclonal antibody (M01), clone 4G4
  • UBR2 monoclonal antibody (M01), clone 4G4

UBR2 monoclonal antibody (M01), clone 4G4

Ref: AB-H00023304-M01
UBR2 monoclonal antibody (M01), clone 4G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UBR2.
Información adicional
Size 100 ug
Gene Name UBR2
Gene Alias C6orf133|DKFZp686C08114|KIAA0349|MGC71112|RP3-392M17.3|bA49A4.1|dJ242G1.1|dJ392M17.3
Gene Description ubiquitin protein ligase E3 component n-recognin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBR2 (NP_056070, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23304
Clone Number 4G4
Iso type IgG2a Kappa

Enviar un mensaje


UBR2 monoclonal antibody (M01), clone 4G4

UBR2 monoclonal antibody (M01), clone 4G4