UBR2 MaxPab mouse polyclonal antibody (B01P)
  • UBR2 MaxPab mouse polyclonal antibody (B01P)

UBR2 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023304-B01P
UBR2 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human UBR2 protein.
Información adicional
Size 50 ug
Gene Name UBR2
Gene Alias C6orf133|DKFZp686C08114|KIAA0349|MGC71112|RP3-392M17.3|bA49A4.1|dJ242G1.1|dJ392M17.3
Gene Description ubiquitin protein ligase E3 component n-recognin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCGRVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGGGGFCDCGDTEAWKEGPYCQKHELNTSEIEEEEDPLVHLSEDVIARTYNIFAITFRYAVEILTWEKESELPADLEMVEKSDTYYCMLFNDEVHTYEQVIYTLQKAVNCTQK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UBR2 (AAH64512.1, 1 a.a. ~ 439 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23304

Enviar un mensaje


UBR2 MaxPab mouse polyclonal antibody (B01P)

UBR2 MaxPab mouse polyclonal antibody (B01P)