KIF13B polyclonal antibody (A01)
  • KIF13B polyclonal antibody (A01)

KIF13B polyclonal antibody (A01)

Ref: AB-H00023303-A01
KIF13B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KIF13B.
Información adicional
Size 50 uL
Gene Name KIF13B
Gene Alias GAKIN|KIAA0639
Gene Description kinesin family member 13B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGDSKVKVAVRIRPMNRRETDLHTKCVVDVDANKVILNPVNTNLSKGDARGQPKVFAYDHCFWSMDESVKEKYAGQDIVFKCLGENILQNAFDGYNACIF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KIF13B (NP_056069, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23303

Enviar un mensaje


KIF13B polyclonal antibody (A01)

KIF13B polyclonal antibody (A01)