ANKS1A purified MaxPab mouse polyclonal antibody (B01P)
  • ANKS1A purified MaxPab mouse polyclonal antibody (B01P)

ANKS1A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023294-B01P
ANKS1A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ANKS1A protein.
Información adicional
Size 50 ug
Gene Name ANKS1A
Gene Alias ANKS1|KIAA0229|MGC42354
Gene Description ankyrin repeat and sterile alpha motif domain containing 1A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSSIGEGIDFSQERQKISGSRTLEQSVGEWLESIGLQQYESKLLLNGFDDVHFLGSNVMEEQDLRDIGISDPQHRRKLLQAARSLPKVKALGYDGNSPPSVPSWLDSLGLQDYVHSFLSSGYSSIDTVKNLWELELVNVLKVQLLGHRKRIIASLADRPYEEPPQKPPRFSQLRCQDLLSQTSSPLSQNDSCTGRSADLLLPPGDTGRRRHDSLHDPAAPSRAERFRIQEEHREAKLTLRPPSLAAPYAPVQSWQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ANKS1A (AAH49213.1, 1 a.a. ~ 460 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23294

Enviar un mensaje


ANKS1A purified MaxPab mouse polyclonal antibody (B01P)

ANKS1A purified MaxPab mouse polyclonal antibody (B01P)