AGTPBP1 polyclonal antibody (A01)
  • AGTPBP1 polyclonal antibody (A01)

AGTPBP1 polyclonal antibody (A01)

Ref: AB-H00023287-A01
AGTPBP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant AGTPBP1.
Información adicional
Size 50 uL
Gene Name AGTPBP1
Gene Alias DKFZp686M20191|KIAA1035|NNA1
Gene Description ATP/GTP binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq GAKFCVGLLRLKRLTSPLEYNLPSSLLDFENDLIESSCKVTSPTTYVLDEDEPRFLEEVDYSAESNDELDIELAENVGDYEPSAQEEVLSDSELSRTYLP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AGTPBP1 (NP_056054, 1087 a.a. ~ 1186 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23287

Enviar un mensaje


AGTPBP1 polyclonal antibody (A01)

AGTPBP1 polyclonal antibody (A01)