DNMBP monoclonal antibody (M03), clone 3H7
  • DNMBP monoclonal antibody (M03), clone 3H7

DNMBP monoclonal antibody (M03), clone 3H7

Ref: AB-H00023268-M03
DNMBP monoclonal antibody (M03), clone 3H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DNMBP.
Información adicional
Size 100 ug
Gene Name DNMBP
Gene Alias KIAA1010|TUBA
Gene Description dynamin binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq TKKPFERKTIDRQSARKPLLGLPSYMLQSEELRASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DNMBP (AAH41628, 491 a.a. ~ 590 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23268
Clone Number 3H7
Iso type IgG3 Kappa

Enviar un mensaje


DNMBP monoclonal antibody (M03), clone 3H7

DNMBP monoclonal antibody (M03), clone 3H7