PLCB1 polyclonal antibody (A01)
  • PLCB1 polyclonal antibody (A01)

PLCB1 polyclonal antibody (A01)

Ref: AB-H00023236-A01
PLCB1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PLCB1.
Información adicional
Size 50 uL
Gene Name PLCB1
Gene Alias FLJ45792|PI-PLC|PLC-154|PLC-I|PLC154
Gene Description phospholipase C, beta 1 (phosphoinositide-specific)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq VQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKPKLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSSEELGGDIPGKEFDTPL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLCB1 (NP_056007, 1107 a.a. ~ 1216 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23236

Enviar un mensaje


PLCB1 polyclonal antibody (A01)

PLCB1 polyclonal antibody (A01)