SIK2 MaxPab mouse polyclonal antibody (B01P) Ver mas grande

SIK2 MaxPab mouse polyclonal antibody (B01P)

AB-H00023235-B01P

Producto nuevo

SIK2 MaxPab mouse polyclonal antibody (B01P)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 50 ug
Gene Name SIK2
Gene Alias DKFZp434K1115|KIAA0781|LOH11CR1I|QIK|SNF1LK2
Gene Description salt-inducible kinase 2
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVMADGPRHLQRGPVRVGFYDIEGTLGKGNFAVVKLGRHRITKTEVAIKIIDKSQLDAVNLEKIYREVQIMKMLDHPHIIKLYQVMETKSMLYLVTEYAKNGEIFDYLANHGRLNESEARRKFWQILSAVDYCHGRKIVHRDLKAENLLLDNNMNIKIADFGFGNFFKSGELLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPTLPILRQRVLEGRFRIPYFMSEDCEHLIRRMLVLD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SIK2 (NP_056006.1, 1 a.a. ~ 926 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23235

Más información

Mouse polyclonal antibody raised against a full-length human SIK2 protein.

Consulta sobre un producto

SIK2 MaxPab mouse polyclonal antibody (B01P)

SIK2 MaxPab mouse polyclonal antibody (B01P)