PLCL2 monoclonal antibody (M02), clone 1C7
  • PLCL2 monoclonal antibody (M02), clone 1C7

PLCL2 monoclonal antibody (M02), clone 1C7

Ref: AB-H00023228-M02
PLCL2 monoclonal antibody (M02), clone 1C7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PLCL2.
Información adicional
Size 100 ug
Gene Name PLCL2
Gene Alias FLJ13484|KIAA1092|PLCE2
Gene Description phospholipase C-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq RYLISYGKHTLDMLESSQDNMRTSWVSQMFSEIDVDNLGHITLCNAVQCIRNLNPGLKTSKIELKFKELHKSKDKAGTEVTKEEFIEVFH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLCL2 (AAH36392, 121 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23228
Clone Number 1C7
Iso type IgG2a Kappa

Enviar un mensaje


PLCL2 monoclonal antibody (M02), clone 1C7

PLCL2 monoclonal antibody (M02), clone 1C7