SYNE2 polyclonal antibody (A01)
  • SYNE2 polyclonal antibody (A01)

SYNE2 polyclonal antibody (A01)

Ref: AB-H00023224-A01
SYNE2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SYNE2.
Información adicional
Size 50 uL
Gene Name SYNE2
Gene Alias DKFZp434H2235|DKFZp686E01115|DKFZp686H1931|FLJ11014|FLJ43727|FLJ45710|FLJ46790|KIAA1011|NUA|NUANCE|Nesprin-2|SYNE-2
Gene Description spectrin repeat containing, nuclear envelope 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq CRRELMQLEKELVERQPQVDMLQEISNSLLIKGHGEDCIEAEEKVHVIEKKLKQLREQVSQDLMALQGTQNPASPLPSFDEVDSGDQPPATSVPAPRA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SYNE2 (NP_055995, 6702 a.a. ~ 6799 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23224

Enviar un mensaje


SYNE2 polyclonal antibody (A01)

SYNE2 polyclonal antibody (A01)