RRP12 purified MaxPab mouse polyclonal antibody (B01P)
  • RRP12 purified MaxPab mouse polyclonal antibody (B01P)

RRP12 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023223-B01P
RRP12 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RRP12 protein.
Información adicional
Size 50 ug
Gene Name RRP12
Gene Alias DKFZp762P1116|FLJ20231|KIAA0690
Gene Description ribosomal RNA processing 12 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MGRSGKLPSGVSAKLKRWKKGHSSDSNPAICRHRQAARSRFFSRPSGRSDLTVDAVKLHNELQSGSLRLGKSEAPETPMEEEAELVLTEKSSGTFLSGLSDCTNVTFSKVQRFWESNSAAHKEICAVLAAVTEVIRSQGGKETETEYFAALMTTMEAVESPESLAAVAYLLNLVLKRVPSPVLIKKFSDTSKAFMDIMSAQASSGSTSVLRWVLSCLATLLRKQDLEAWGYPVTLQVYHGLLSFTVHPKPKIRKA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RRP12 (NP_055994.1, 1 a.a. ~ 1297 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23223

Enviar un mensaje


RRP12 purified MaxPab mouse polyclonal antibody (B01P)

RRP12 purified MaxPab mouse polyclonal antibody (B01P)