RHOBTB2 purified MaxPab mouse polyclonal antibody (B01P)
  • RHOBTB2 purified MaxPab mouse polyclonal antibody (B01P)

RHOBTB2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023221-B01P
RHOBTB2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RHOBTB2 protein.
Información adicional
Size 50 ug
Gene Name RHOBTB2
Gene Alias DBC2|KIAA0717
Gene Description Rho-related BTB domain containing 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDSDMDYERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQEVLERSRDVVDDVSVSLRLWDTFGDHHKDRRFAYGRSDVVVLCFSIANPNSLHHVKTMWYPEIKHFCPRAPVILVGCQLDLRYADLEAVNRARRPLARPIKPNEILPPEKGREVAKELGIPYYETSVVAQFGIKDVFDNAIRAALISRRHLQFWKSHLRNVQRPLLQAPFLPPKPPPPIIVVPDPPSSSEEC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RHOBTB2 (AAH34917.1, 1 a.a. ~ 727 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23221

Enviar un mensaje


RHOBTB2 purified MaxPab mouse polyclonal antibody (B01P)

RHOBTB2 purified MaxPab mouse polyclonal antibody (B01P)