Ver mas grande
SULF1 monoclonal antibody (M01A), clone 1A4
AB-H00023213-M01A
Producto nuevo
SULF1 monoclonal antibody (M01A), clone 1A4
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 200 uL |
| Gene Name | SULF1 |
| Gene Alias | FLJ30905|FLJ38022|FLJ41750|HSULF-1|KIAA1077|SULF-1 |
| Gene Description | sulfatase 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SULF1 (NP_055985.1, 780 a.a. ~ 871 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 23213 |
| Clone Number | 1A4 |
| Iso type | IgM Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant SULF1.