SULF1 monoclonal antibody (M01A), clone 1A4
  • SULF1 monoclonal antibody (M01A), clone 1A4

SULF1 monoclonal antibody (M01A), clone 1A4

Ref: AB-H00023213-M01A
SULF1 monoclonal antibody (M01A), clone 1A4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SULF1.
Información adicional
Size 200 uL
Gene Name SULF1
Gene Alias FLJ30905|FLJ38022|FLJ41750|HSULF-1|KIAA1077|SULF-1
Gene Description sulfatase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SULF1 (NP_055985.1, 780 a.a. ~ 871 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 23213
Clone Number 1A4
Iso type IgM Kappa

Enviar un mensaje


SULF1 monoclonal antibody (M01A), clone 1A4

SULF1 monoclonal antibody (M01A), clone 1A4