ATP11B polyclonal antibody (A01)
  • ATP11B polyclonal antibody (A01)

ATP11B polyclonal antibody (A01)

Ref: AB-H00023200-A01
ATP11B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ATP11B.
Información adicional
Size 50 uL
Gene Name ATP11B
Gene Alias ATPIF|ATPIR|DKFZp434J238|DKFZp434N1615|KIAA0956|MGC46576
Gene Description ATPase, class VI, type 11B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGRMLERVIGRCSPTHISRSWSASDPFYTNDRSILTLSTMDSSTC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ATP11B (NP_055431, 1087 a.a. ~ 1177 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23200

Enviar un mensaje


ATP11B polyclonal antibody (A01)

ATP11B polyclonal antibody (A01)