GANAB MaxPab rabbit polyclonal antibody (D01)
  • GANAB MaxPab rabbit polyclonal antibody (D01)

GANAB MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00023193-D01
GANAB MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GANAB protein.
Información adicional
Size 100 uL
Gene Name GANAB
Gene Alias G2AN|GluII|KIAA0088
Gene Description glucosidase, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP,IF
Immunogen Prot. Seq MAAVAAVAARRRRSWASLVLAFLGVCLGITLAVDRSNFKTCEESSFCKRQRSIRPGLSPYRALLDSLQLGPDSLTVHLIHEVTKVLLVLELQGLQKNMTRFRIDELEPRRPRYRVPDVLVADPPIARLSVSGRDENSVELTMAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLEFEHQRAPRVSQGSKDPAEGDGAQPEETPRDGDKPEETQGKAEKDEPGAWEETFKTHSDSKPYGPMSVGLDFSLPGMEH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GANAB (NP_938148.1, 1 a.a. ~ 944 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 23193

Enviar un mensaje


GANAB MaxPab rabbit polyclonal antibody (D01)

GANAB MaxPab rabbit polyclonal antibody (D01)