DIP2A purified MaxPab rabbit polyclonal antibody (D01P)
  • DIP2A purified MaxPab rabbit polyclonal antibody (D01P)

DIP2A purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023181-D01P
DIP2A purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DIP2A protein.
Información adicional
Size 100 ug
Gene Name DIP2A
Gene Alias C21orf106|DIP2
Gene Description DIP2 disco-interacting protein 2 homolog A (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MADRGCPLEAAPLPAEVRESLAELELELSEGDITQKGYEKKRAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRSDVHTEAVQAALAKYKERKMPMPSKRRSVLVHSSVETYTPPDTSSASEDEGSLRRPGRLTSTPLQSHSSVEPWLDRVIQGSSTSSSASSTSSHPGGRPTTAPSAAATPGAAATTALAGLEAHTHIDLHSAPPDVTTGLVEHSYFERPQVASVRSVPRGCSGS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DIP2A (NP_996772.1, 1 a.a. ~ 889 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23181

Enviar un mensaje


DIP2A purified MaxPab rabbit polyclonal antibody (D01P)

DIP2A purified MaxPab rabbit polyclonal antibody (D01P)