DIP2A polyclonal antibody (A01)
  • DIP2A polyclonal antibody (A01)

DIP2A polyclonal antibody (A01)

Ref: AB-H00023181-A01
DIP2A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DIP2A.
Información adicional
Size 50 uL
Gene Name DIP2A
Gene Alias C21orf106|DIP2
Gene Description DIP2 disco-interacting protein 2 homolog A (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MADRGCPLEAAPLPAEVRESLAELELELSEGDITQKGYEKKRAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRSDVHTE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DIP2A (NP_055966, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23181

Enviar un mensaje


DIP2A polyclonal antibody (A01)

DIP2A polyclonal antibody (A01)