PASK monoclonal antibody (M01), clone 6D10
  • PASK monoclonal antibody (M01), clone 6D10

PASK monoclonal antibody (M01), clone 6D10

Ref: AB-H00023178-M01
PASK monoclonal antibody (M01), clone 6D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PASK.
Información adicional
Size 100 ug
Gene Name PASK
Gene Alias DKFZp434O051|DKFZp686P2031|KIAA0135|PASKIN|STK37
Gene Description PAS domain containing serine/threonine kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MEDGGLTAFEEDQRCLSQSLPLPVSAEGPAAQTTAEPSRSFSSAHRHLSRRNGLSRLCQSRTALSEDRWSSYCLSSLAAQNICTSKLHCPAAPEHTDPSE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PASK (AAH63585, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23178
Clone Number 6D10
Iso type IgG1 Kappa

Enviar un mensaje


PASK monoclonal antibody (M01), clone 6D10

PASK monoclonal antibody (M01), clone 6D10