STAB1 monoclonal antibody (M05), clone 4G9
  • STAB1 monoclonal antibody (M05), clone 4G9

STAB1 monoclonal antibody (M05), clone 4G9

Ref: AB-H00023166-M05
STAB1 monoclonal antibody (M05), clone 4G9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STAB1.
Información adicional
Size 100 ug
Gene Name STAB1
Gene Alias CLEVER-1|FEEL-1|FELE-1|FEX1|KIAA0246|STAB-1
Gene Description stabilin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STAB1 (NP_055951, 1804 a.a. ~ 1902 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23166
Clone Number 4G9
Iso type IgG2a Kappa

Enviar un mensaje


STAB1 monoclonal antibody (M05), clone 4G9

STAB1 monoclonal antibody (M05), clone 4G9