STAB1 polyclonal antibody (A01)
  • STAB1 polyclonal antibody (A01)

STAB1 polyclonal antibody (A01)

Ref: AB-H00023166-A01
STAB1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant STAB1.
Información adicional
Size 50 uL
Gene Name STAB1
Gene Alias CLEVER-1|FEEL-1|FELE-1|FEX1|KIAA0246|STAB-1
Gene Description stabilin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STAB1 (NP_055951, 1804 a.a. ~ 1902 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23166

Enviar un mensaje


STAB1 polyclonal antibody (A01)

STAB1 polyclonal antibody (A01)