NCDN purified MaxPab mouse polyclonal antibody (B01P)
  • NCDN purified MaxPab mouse polyclonal antibody (B01P)

NCDN purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023154-B01P
NCDN purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NCDN protein.
Información adicional
Size 50 ug
Gene Name NCDN
Gene Alias KIAA0607
Gene Description neurochondrin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDSEQFAALLLVTKAVKAGDIDAKTRRRIFDAVGFTFPNRLLTTKEAPDGCPDHVLRALGVALLACFCSDPELAAHPQVLNKIPILSTFLTARGDPDDAARRSMIDDTYQCLTAVAGTPRGPRHLIAGGTVSALCQAYLGHGYGFDQALALLVGLLAAAETQCWKEAEPDLLAVLRGLSEDFQKAEDASKFELCQLLPLFLPPTTVPP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NCDN (NP_055099.1, 1 a.a. ~ 729 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23154

Enviar un mensaje


NCDN purified MaxPab mouse polyclonal antibody (B01P)

NCDN purified MaxPab mouse polyclonal antibody (B01P)