POGZ purified MaxPab mouse polyclonal antibody (B01P)
  • POGZ purified MaxPab mouse polyclonal antibody (B01P)

POGZ purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023126-B01P
POGZ purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human POGZ protein.
Información adicional
Size 50 ug
Gene Name POGZ
Gene Alias KIAA0461|MGC71543|SUHW5|ZNF280E|ZNF635|ZNF635m
Gene Description pogo transposable element with ZNF domain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MADTDLFMECEEEELEPWQKISDVIEDSVVEDYNSVDKTTTAGNPLVQQGGQPLILTQNPAPGLGTMVTQPVLRPVQVMQNANHVTSSPVASQPIFITTQGFPVRNVRPVQNAMNQVGIVLNVQQGQTVRPITLVPAPGTQFVKPTVGVPQVFSQMTPVRPGSTMPVRPTTNTFTTVIPATLTIRSTVPQSQSQQTKSTPSTSTTPTATQPTSLGQLAVQSPGQSNQTTNPKLAPSFPSPPAVSIASFVTVKRPG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen POGZ (NP_997054.1, 1 a.a. ~ 1357 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23126

Enviar un mensaje


POGZ purified MaxPab mouse polyclonal antibody (B01P)

POGZ purified MaxPab mouse polyclonal antibody (B01P)