PARC monoclonal antibody (M01), clone 3F7
  • PARC monoclonal antibody (M01), clone 3F7

PARC monoclonal antibody (M01), clone 3F7

Ref: AB-H00023113-M01
PARC monoclonal antibody (M01), clone 3F7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PARC.
Información adicional
Size 100 ug
Gene Name CUL9
Gene Alias DKFZp686G1042|DKFZp686P2024|H7AP1|PARC|RP3-330M21.2
Gene Description cullin 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MMLLNRYSEPPGSPERAALETPIIQGQDGSPELLIRSLVGGPSAELLLDLERVLCREGSPGGAVRPLLKRLQQETQPFLLLLRTLDAPGPNKTLLLSVLRVITRLLDF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PARC (NP_055904, 918 a.a. ~ 1025 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23113
Clone Number 3F7
Iso type IgG2a Kappa

Enviar un mensaje


PARC monoclonal antibody (M01), clone 3F7

PARC monoclonal antibody (M01), clone 3F7