TNRC6B monoclonal antibody (M02), clone 4B11
  • TNRC6B monoclonal antibody (M02), clone 4B11

TNRC6B monoclonal antibody (M02), clone 4B11

Ref: AB-H00023112-M02
TNRC6B monoclonal antibody (M02), clone 4B11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TNRC6B.
Información adicional
Size 100 ug
Gene Name TNRC6B
Gene Alias KIAA1093
Gene Description trinucleotide repeat containing 6B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ECNLGVWKSDPKAKSVQSSNSTTENNNGLGNWRNVSGQDRIGPGSGFSNFNPNSNPSAWPALVQEGTSRKGALETDNSNSSAQVSTVGQTSREQQSKMEN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNRC6B (NP_055903, 253 a.a. ~ 352 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23112
Clone Number 4B11
Iso type IgG2a Kappa

Enviar un mensaje


TNRC6B monoclonal antibody (M02), clone 4B11

TNRC6B monoclonal antibody (M02), clone 4B11