MRPS27 monoclonal antibody (M06), clone 1G3
  • MRPS27 monoclonal antibody (M06), clone 1G3

MRPS27 monoclonal antibody (M06), clone 1G3

Ref: AB-H00023107-M06
MRPS27 monoclonal antibody (M06), clone 1G3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant MRPS27.
Información adicional
Size 100 ug
Gene Name MRPS27
Gene Alias FLJ21764|FLJ23348|KIAA0264|MRP-S27|S27mt
Gene Description mitochondrial ribosomal protein S27
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq SEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MRPS27 (AAH30521, 51 a.a. ~ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23107
Clone Number 1G3
Iso type IgG2a Kappa

Enviar un mensaje


MRPS27 monoclonal antibody (M06), clone 1G3

MRPS27 monoclonal antibody (M06), clone 1G3