CDC2L6 monoclonal antibody (M02), clone 2F11
  • CDC2L6 monoclonal antibody (M02), clone 2F11

CDC2L6 monoclonal antibody (M02), clone 2F11

Ref: AB-H00023097-M02
CDC2L6 monoclonal antibody (M02), clone 2F11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDC2L6.
Información adicional
Size 100 ug
Gene Name CDC2L6
Gene Alias CDK11|KIAA1028|bA346C16.3
Gene Description cell division cycle 2-like 6 (CDK8-like)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,ELISA
Immunogen Prot. Seq MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDC2L6 (NP_055891.1, 1 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23097
Clone Number 2F11
Iso type IgG2a Kappa

Enviar un mensaje


CDC2L6 monoclonal antibody (M02), clone 2F11

CDC2L6 monoclonal antibody (M02), clone 2F11