CDC2L6 purified MaxPab rabbit polyclonal antibody (D01P)
  • CDC2L6 purified MaxPab rabbit polyclonal antibody (D01P)

CDC2L6 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023097-D01P
CDC2L6 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CDC2L6 protein.
Información adicional
Size 100 ug
Gene Name CDC2L6
Gene Alias CDK11|KIAA1028|bA346C16.3
Gene Description cell division cycle 2-like 6 (CDK8-like)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDC2L6 (NP_055891.1, 1 a.a. ~ 502 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23097

Enviar un mensaje


CDC2L6 purified MaxPab rabbit polyclonal antibody (D01P)

CDC2L6 purified MaxPab rabbit polyclonal antibody (D01P)