ARHGAP26 polyclonal antibody (A01)
  • ARHGAP26 polyclonal antibody (A01)

ARHGAP26 polyclonal antibody (A01)

Ref: AB-H00023092-A01
ARHGAP26 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ARHGAP26.
Información adicional
Size 50 uL
Gene Name ARHGAP26
Gene Alias FLJ42530|GRAF|KIAA0621|OPHN1L|OPHN1L1
Gene Description Rho GTPase activating protein 26
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LMKKMKENPLEHKTISPYTMEGYLYVQEKRHFGTSWVKHYCTYQRDSKQITMVPFDQKSGGKGGEDESVILKSCTRRKTDSIEKRFCF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARHGAP26 (NP_055886, 249 a.a. ~ 336 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23092

Enviar un mensaje


ARHGAP26 polyclonal antibody (A01)

ARHGAP26 polyclonal antibody (A01)