ERC1 purified MaxPab mouse polyclonal antibody (B01P)
  • ERC1 purified MaxPab mouse polyclonal antibody (B01P)

ERC1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023085-B01P
ERC1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ERC1 protein.
Información adicional
Size 50 ug
Gene Name ERC1
Gene Alias Cast2|ELKS|KIAA1081|MGC12974|RAB6IP2
Gene Description ELKS/RAB6-interacting/CAST family member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPKQVVWHGHWPAALSKQVAQIPPTWTFSSGAAPATLSHWVCDSPLHLSILHHFPSRKTDGRKPSVTLLLRRSISGTDIICLVSVNSKESS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ERC1 (AAH05065.1, 1 a.a. ~ 91 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23085

Enviar un mensaje


ERC1 purified MaxPab mouse polyclonal antibody (B01P)

ERC1 purified MaxPab mouse polyclonal antibody (B01P)