SWAP70 monoclonal antibody (M09A), clone 3H8
  • SWAP70 monoclonal antibody (M09A), clone 3H8

SWAP70 monoclonal antibody (M09A), clone 3H8

Ref: AB-H00023075-M09A
SWAP70 monoclonal antibody (M09A), clone 3H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SWAP70.
Información adicional
Size 200 uL
Gene Name SWAP70
Gene Alias FLJ39540|HSPC321|KIAA0640|SWAP-70
Gene Description SWAP-70 protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq QTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SWAP70 (NP_055870, 378 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 23075
Clone Number 3H8
Iso type IgG2a Kappa

Enviar un mensaje


SWAP70 monoclonal antibody (M09A), clone 3H8

SWAP70 monoclonal antibody (M09A), clone 3H8