SWAP70 monoclonal antibody (M04), clone 1A12
  • SWAP70 monoclonal antibody (M04), clone 1A12

SWAP70 monoclonal antibody (M04), clone 1A12

Ref: AB-H00023075-M04
SWAP70 monoclonal antibody (M04), clone 1A12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SWAP70.
Información adicional
Size 100 ug
Gene Name SWAP70
Gene Alias FLJ39540|HSPC321|KIAA0640|SWAP-70
Gene Description SWAP-70 protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq QTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SWAP70 (NP_055870, 378 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23075
Clone Number 1A12
Iso type IgG1 Kappa

Enviar un mensaje


SWAP70 monoclonal antibody (M04), clone 1A12

SWAP70 monoclonal antibody (M04), clone 1A12